SLC7A1 monoclonal antibody (M02), clone 2B9
  • SLC7A1 monoclonal antibody (M02), clone 2B9

SLC7A1 monoclonal antibody (M02), clone 2B9

Ref: AB-H00006541-M02
SLC7A1 monoclonal antibody (M02), clone 2B9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC7A1.
Información adicional
Size 100 ug
Gene Name SLC7A1
Gene Alias ATRC1|CAT-1|ERR|HCAT1|REC1L
Gene Description solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC7A1 (NP_003036, 431 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6541
Clone Number 2B9
Iso type IgG1 Kappa

Enviar un mensaje


SLC7A1 monoclonal antibody (M02), clone 2B9

SLC7A1 monoclonal antibody (M02), clone 2B9