SLC6A3 purified MaxPab rabbit polyclonal antibody (D01P)
  • SLC6A3 purified MaxPab rabbit polyclonal antibody (D01P)

SLC6A3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006531-D01P
SLC6A3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SLC6A3 protein.
Información adicional
Size 100 ug
Gene Name SLC6A3
Gene Alias DAT|DAT1
Gene Description solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC6A3 (NP_001035.1, 1 a.a. ~ 620 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6531

Enviar un mensaje


SLC6A3 purified MaxPab rabbit polyclonal antibody (D01P)

SLC6A3 purified MaxPab rabbit polyclonal antibody (D01P)