SLC6A3 polyclonal antibody (A01)
  • SLC6A3 polyclonal antibody (A01)

SLC6A3 polyclonal antibody (A01)

Ref: AB-H00006531-A01
SLC6A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC6A3.
Información adicional
Size 50 uL
Gene Name SLC6A3
Gene Alias DAT|DAT1
Gene Description solute carrier family 6 (neurotransmitter transporter, dopamine), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC6A3 (NP_001035, 161 a.a. ~ 237 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6531

Enviar un mensaje


SLC6A3 polyclonal antibody (A01)

SLC6A3 polyclonal antibody (A01)