SLC5A3 monoclonal antibody (M02), clone 3A6
  • SLC5A3 monoclonal antibody (M02), clone 3A6

SLC5A3 monoclonal antibody (M02), clone 3A6

Ref: AB-H00006526-M02
SLC5A3 monoclonal antibody (M02), clone 3A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC5A3.
Información adicional
Size 100 ug
Gene Name SLC5A3
Gene Alias SMIT|SMIT2
Gene Description solute carrier family 5 (sodium/myo-inositol cotransporter), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC5A3 (NP_008864, 533 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6526
Clone Number 3A6
Iso type IgG1 Kappa

Enviar un mensaje


SLC5A3 monoclonal antibody (M02), clone 3A6

SLC5A3 monoclonal antibody (M02), clone 3A6