SLC5A2 monoclonal antibody (M01), clone 3G8
  • SLC5A2 monoclonal antibody (M01), clone 3G8

SLC5A2 monoclonal antibody (M01), clone 3G8

Ref: AB-H00006524-M01
SLC5A2 monoclonal antibody (M01), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC5A2.
Información adicional
Size 100 ug
Gene Name SLC5A2
Gene Alias SGLT2
Gene Description solute carrier family 5 (sodium/glucose cotransporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC5A2 (NP_003032.1, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6524
Clone Number 3G8
Iso type IgG2a Kappa

Enviar un mensaje


SLC5A2 monoclonal antibody (M01), clone 3G8

SLC5A2 monoclonal antibody (M01), clone 3G8