SLC4A1 monoclonal antibody (M02), clone 2D5
  • SLC4A1 monoclonal antibody (M02), clone 2D5

SLC4A1 monoclonal antibody (M02), clone 2D5

Ref: AB-H00006521-M02
SLC4A1 monoclonal antibody (M02), clone 2D5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC4A1.
Información adicional
Size 100 ug
Gene Name SLC4A1
Gene Alias AE1|BND3|CD233|DI|EMPB3|EPB3|FR|MGC116750|MGC116753|MGC126619|MGC126623|RTA1A|SW|WD|WD1|WR
Gene Description solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC4A1 (NP_000333.1, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6521
Clone Number 2D5
Iso type IgG1 Kappa

Enviar un mensaje


SLC4A1 monoclonal antibody (M02), clone 2D5

SLC4A1 monoclonal antibody (M02), clone 2D5