SLC3A2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SLC3A2 purified MaxPab rabbit polyclonal antibody (D01P)

SLC3A2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006520-D01P
SLC3A2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SLC3A2 protein.
Información adicional
Size 100 ug
Gene Name SLC3A2
Gene Alias 4F2|4F2HC|4T2HC|CD98|CD98HC|MDU1|NACAE
Gene Description solute carrier family 3 (activators of dibasic and neutral amino acid transport), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC3A2 (NP_001013269.1, 1 a.a. ~ 529 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6520

Enviar un mensaje


SLC3A2 purified MaxPab rabbit polyclonal antibody (D01P)

SLC3A2 purified MaxPab rabbit polyclonal antibody (D01P)