SLC2A4 monoclonal antibody (M08), clone 2D6
  • SLC2A4 monoclonal antibody (M08), clone 2D6

SLC2A4 monoclonal antibody (M08), clone 2D6

Ref: AB-H00006517-M08
SLC2A4 monoclonal antibody (M08), clone 2D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC2A4.
Información adicional
Size 100 ug
Gene Name SLC2A4
Gene Alias GLUT4
Gene Description solute carrier family 2 (facilitated glucose transporter), member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC2A4 (NP_001033, 467 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6517
Clone Number 2D6
Iso type IgG2b Kappa

Enviar un mensaje


SLC2A4 monoclonal antibody (M08), clone 2D6

SLC2A4 monoclonal antibody (M08), clone 2D6