SLC1A3 purified MaxPab rabbit polyclonal antibody (D01P)
  • SLC1A3 purified MaxPab rabbit polyclonal antibody (D01P)

SLC1A3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006507-D01P
SLC1A3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SLC1A3 protein.
Información adicional
Size 100 ug
Gene Name SLC1A3
Gene Alias EA6|EAAT1|FLJ25094|GLAST|GLAST1
Gene Description solute carrier family 1 (glial high affinity glutamate transporter), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTKSNGEEPKMGGRMERFQQGVSKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGTILGFTLRPYRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGIIIVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFSMCFGF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC1A3 (NP_004163.2, 1 a.a. ~ 542 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6507

Enviar un mensaje


SLC1A3 purified MaxPab rabbit polyclonal antibody (D01P)

SLC1A3 purified MaxPab rabbit polyclonal antibody (D01P)