SLC1A2 monoclonal antibody (M10), clone 4G8
  • SLC1A2 monoclonal antibody (M10), clone 4G8

SLC1A2 monoclonal antibody (M10), clone 4G8

Ref: AB-H00006506-M10
SLC1A2 monoclonal antibody (M10), clone 4G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC1A2.
Información adicional
Size 100 ug
Gene Name SLC1A2
Gene Alias EAAT2|GLT-1
Gene Description solute carrier family 1 (glial high affinity glutamate transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC1A2 (NP_004162, 160 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6506
Clone Number 4G8
Iso type IgG2a Kappa

Enviar un mensaje


SLC1A2 monoclonal antibody (M10), clone 4G8

SLC1A2 monoclonal antibody (M10), clone 4G8