SKP1A monoclonal antibody (M01), clone 1H8
  • SKP1A monoclonal antibody (M01), clone 1H8

SKP1A monoclonal antibody (M01), clone 1H8

Ref: AB-H00006500-M01
SKP1A monoclonal antibody (M01), clone 1H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SKP1A.
Información adicional
Size 100 ug
Gene Name SKP1
Gene Alias EMC19|MGC34403|OCP-II|OCP2|SKP1A|TCEB1L|p19A
Gene Description S-phase kinase-associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq AILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SKP1A (NP_008861, 53 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6500
Clone Number 1H8
Iso type IgG2a Kappa

Enviar un mensaje


SKP1A monoclonal antibody (M01), clone 1H8

SKP1A monoclonal antibody (M01), clone 1H8