SKP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SKP1 purified MaxPab rabbit polyclonal antibody (D01P)

SKP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006500-D01P
SKP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SKP1 protein.
Información adicional
Size 100 ug
Gene Name SKP1
Gene Alias EMC19|MGC34403|OCP-II|OCP2|SKP1A|TCEB1L|p19A
Gene Description S-phase kinase-associated protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,PLA-Ce
Immunogen Prot. Seq MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGSTQFCL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SKP1 (NP_008861.2, 1 a.a. ~ 160 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6500

Enviar un mensaje


SKP1 purified MaxPab rabbit polyclonal antibody (D01P)

SKP1 purified MaxPab rabbit polyclonal antibody (D01P)