SKIV2L monoclonal antibody (M05A), clone 1E5
  • SKIV2L monoclonal antibody (M05A), clone 1E5

SKIV2L monoclonal antibody (M05A), clone 1E5

Ref: AB-H00006499-M05A
SKIV2L monoclonal antibody (M05A), clone 1E5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SKIV2L.
Información adicional
Size 200 uL
Gene Name SKIV2L
Gene Alias 170A|DDX13|HLP|SKI2|SKI2W|SKIV2
Gene Description superkiller viralicidic activity 2-like (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq DQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SKIV2L (NP_008860, 1125 a.a. ~ 1233 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 6499
Clone Number 1E5
Iso type IgG2a Kappa

Enviar un mensaje


SKIV2L monoclonal antibody (M05A), clone 1E5

SKIV2L monoclonal antibody (M05A), clone 1E5