SIX3 purified MaxPab mouse polyclonal antibody (B01P)
  • SIX3 purified MaxPab mouse polyclonal antibody (B01P)

SIX3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006496-B01P
SIX3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SIX3 protein.
Información adicional
Size 50 ug
Gene Name SIX3
Gene Alias HPE2
Gene Description SIX homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MVFRSPLDLYSSHFLLPNFADSHHRSILLASSGGGNGAGGGGGAGGGSGGGNGAGGGGAGGAGGGGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SIX3 (AAI53027.1, 1 a.a. ~ 332 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6496

Enviar un mensaje


SIX3 purified MaxPab mouse polyclonal antibody (B01P)

SIX3 purified MaxPab mouse polyclonal antibody (B01P)