ST3GAL4 monoclonal antibody (M01), clone 1F4
  • ST3GAL4 monoclonal antibody (M01), clone 1F4

ST3GAL4 monoclonal antibody (M01), clone 1F4

Ref: AB-H00006484-M01
ST3GAL4 monoclonal antibody (M01), clone 1F4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ST3GAL4.
Información adicional
Size 100 ug
Gene Name ST3GAL4
Gene Alias CGS23|FLJ11867|FLJ46764|NANTA3|SAT3|SIAT4|SIAT4C|ST3GalIV|STZ
Gene Description ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq FYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST3GAL4 (NP_006269, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6484
Clone Number 1F4
Iso type IgG1 Kappa

Enviar un mensaje


ST3GAL4 monoclonal antibody (M01), clone 1F4

ST3GAL4 monoclonal antibody (M01), clone 1F4