ST3GAL4 polyclonal antibody (A01)
  • ST3GAL4 polyclonal antibody (A01)

ST3GAL4 polyclonal antibody (A01)

Ref: AB-H00006484-A01
ST3GAL4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ST3GAL4.
Información adicional
Size 50 uL
Gene Name ST3GAL4
Gene Alias CGS23|FLJ11867|FLJ46764|NANTA3|SAT3|SIAT4|SIAT4C|ST3GalIV|STZ
Gene Description ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq FYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST3GAL4 (NP_006269, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6484

Enviar un mensaje


ST3GAL4 polyclonal antibody (A01)

ST3GAL4 polyclonal antibody (A01)