ST3GAL2 monoclonal antibody (M01), clone 1E12
  • ST3GAL2 monoclonal antibody (M01), clone 1E12

ST3GAL2 monoclonal antibody (M01), clone 1E12

Ref: AB-H00006483-M01
ST3GAL2 monoclonal antibody (M01), clone 1E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ST3GAL2.
Información adicional
Size 100 ug
Gene Name ST3GAL2
Gene Alias Gal-NAc6S|SIAT4B|ST3GALII|ST3GalA.2
Gene Description ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq HHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ST3GAL2 (NP_008858, 28 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6483
Clone Number 1E12
Iso type IgG2a Kappa

Enviar un mensaje


ST3GAL2 monoclonal antibody (M01), clone 1E12

ST3GAL2 monoclonal antibody (M01), clone 1E12