ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)

ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006483-D01P
ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ST3GAL2 protein.
Información adicional
Size 100 ug
Gene Name ST3GAL2
Gene Alias Gal-NAc6S|SIAT4B|ST3GALII|ST3GalA.2
Gene Description ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti
Immunogen Prot. Seq MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRLSKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMNQAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTYAPVKSFLRVDKEKVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ST3GAL2 (NP_008858.1, 1 a.a. ~ 350 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6483

Enviar un mensaje


ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)

ST3GAL2 purified MaxPab rabbit polyclonal antibody (D01P)