SHMT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SHMT1 purified MaxPab rabbit polyclonal antibody (D01P)

SHMT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006470-D01P
SHMT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SHMT1 protein.
Información adicional
Size 100 ug
Gene Name SHMT1
Gene Alias CSHMT|MGC15229|MGC24556|SHMT
Gene Description serine hydroxymethyltransferase 1 (soluble)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYKLDPQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SHMT1 (NP_004160.3, 1 a.a. ~ 483 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6470

Enviar un mensaje


SHMT1 purified MaxPab rabbit polyclonal antibody (D01P)

SHMT1 purified MaxPab rabbit polyclonal antibody (D01P)