SH3BP2 monoclonal antibody (M01), clone 1E9
  • SH3BP2 monoclonal antibody (M01), clone 1E9

SH3BP2 monoclonal antibody (M01), clone 1E9

Ref: AB-H00006452-M01
SH3BP2 monoclonal antibody (M01), clone 1E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SH3BP2.
Información adicional
Size 100 ug
Gene Name SH3BP2
Gene Alias 3BP2|CRBM|CRPM|FLJ42079|RES4-23
Gene Description SH3-domain binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq PLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SH3BP2 (AAH22996, 452 a.a. ~ 561 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6452
Clone Number 1E9
Iso type IgG2a Kappa

Enviar un mensaje


SH3BP2 monoclonal antibody (M01), clone 1E9

SH3BP2 monoclonal antibody (M01), clone 1E9