SGTA monoclonal antibody (M06), clone 2E11
  • SGTA monoclonal antibody (M06), clone 2E11

SGTA monoclonal antibody (M06), clone 2E11

Ref: AB-H00006449-M06
SGTA monoclonal antibody (M06), clone 2E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SGTA.
Información adicional
Size 100 ug
Gene Name SGTA
Gene Alias SGT|alphaSGT|hSGT
Gene Description small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IP,S-ELISA,ELISA,IF
Immunogen Prot. Seq AFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SGTA (NP_003012.1, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6449
Clone Number 2E11
Iso type IgG2b Kappa

Enviar un mensaje


SGTA monoclonal antibody (M06), clone 2E11

SGTA monoclonal antibody (M06), clone 2E11