SGCD monoclonal antibody (M01), clone 3G10
  • SGCD monoclonal antibody (M01), clone 3G10

SGCD monoclonal antibody (M01), clone 3G10

Ref: AB-H00006444-M01
SGCD monoclonal antibody (M01), clone 3G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SGCD.
Información adicional
Size 100 ug
Gene Name SGCD
Gene Alias 35DAG|CMD1L|DAGD|MGC22567|SG-delta|SGCDP|SGD
Gene Description sarcoglycan, delta (35kDa dystrophin-associated glycoprotein)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SGCD (NP_000328.2, 114 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6444
Clone Number 3G10
Iso type IgG1 Kappa

Enviar un mensaje


SGCD monoclonal antibody (M01), clone 3G10

SGCD monoclonal antibody (M01), clone 3G10