SFRS6 monoclonal antibody (M01), clone 6A10
  • SFRS6 monoclonal antibody (M01), clone 6A10

SFRS6 monoclonal antibody (M01), clone 6A10

Ref: AB-H00006431-M01
SFRS6 monoclonal antibody (M01), clone 6A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SFRS6.
Información adicional
Size 100 ug
Gene Name SFRS6
Gene Alias B52|FLJ08061|MGC5045|SRP55
Gene Description splicing factor, arginine/serine-rich 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SFRS6 (NP_006266, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6431
Clone Number 6A10
Iso type IgG3 Kappa

Enviar un mensaje


SFRS6 monoclonal antibody (M01), clone 6A10

SFRS6 monoclonal antibody (M01), clone 6A10