SFRS6 polyclonal antibody (A01)
  • SFRS6 polyclonal antibody (A01)

SFRS6 polyclonal antibody (A01)

Ref: AB-H00006431-A01
SFRS6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SFRS6.
Información adicional
Size 50 uL
Gene Name SFRS6
Gene Alias B52|FLJ08061|MGC5045|SRP55
Gene Description splicing factor, arginine/serine-rich 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHARGPRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SFRS6 (NP_006266, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6431

Enviar un mensaje


SFRS6 polyclonal antibody (A01)

SFRS6 polyclonal antibody (A01)