SFRP4 polyclonal antibody (A01)
  • SFRP4 polyclonal antibody (A01)

SFRP4 polyclonal antibody (A01)

Ref: AB-H00006424-A01
SFRP4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SFRP4.
Información adicional
Size 50 uL
Gene Name SFRP4
Gene Alias FRP-4|FRPHE|MGC26498
Gene Description secreted frizzled-related protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SFRP4 (NP_003005.1, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6424

Enviar un mensaje


SFRP4 polyclonal antibody (A01)

SFRP4 polyclonal antibody (A01)