SETMAR purified MaxPab mouse polyclonal antibody (B01P)
  • SETMAR purified MaxPab mouse polyclonal antibody (B01P)

SETMAR purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006419-B01P
SETMAR purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SETMAR protein.
Información adicional
Size 50 ug
Gene Name SETMAR
Gene Alias METNASE
Gene Description SET domain and mariner transposase fusion gene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAEFKEKPEAPTEQLDVACGQENLPVGAWPPGAAPAPFQYTPDHVVGPGADIDPTQITFPGCICVKTPCLPGTCSCLRHGENYDDNSCLRDIGSGGKYAEPVFECNVLCRCSDHCRNRVVQKGLQFHFQVFKTHKKGWGLRTLEFIPKGRFVCEYAGEVLGFSEVQRRIHLQTKSDSNYIIAIREHVYNGQVMETFVDPTYIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDIVPEEELSYDYSGRYLN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SETMAR (AAH11635.1, 1 a.a. ~ 352 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6419

Enviar un mensaje


SETMAR purified MaxPab mouse polyclonal antibody (B01P)

SETMAR purified MaxPab mouse polyclonal antibody (B01P)