SEC13 purified MaxPab rabbit polyclonal antibody (D01P)
  • SEC13 purified MaxPab rabbit polyclonal antibody (D01P)

SEC13 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006396-D01P
SEC13 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SEC13 protein.
Información adicional
Size 100 ug
Gene Name SEC13
Gene Alias D3S1231E|SEC13L1|SEC13R|npp-20
Gene Description SEC13 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEC13 (NP_899195.1, 1 a.a. ~ 322 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6396

Enviar un mensaje


SEC13 purified MaxPab rabbit polyclonal antibody (D01P)

SEC13 purified MaxPab rabbit polyclonal antibody (D01P)