SEC13L1 polyclonal antibody (A01)
  • SEC13L1 polyclonal antibody (A01)

SEC13L1 polyclonal antibody (A01)

Ref: AB-H00006396-A01
SEC13L1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SEC13L1.
Información adicional
Size 50 uL
Gene Name SEC13
Gene Alias D3S1231E|SEC13L1|SEC13R|npp-20
Gene Description SEC13 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEC13L1 (NP_109598, 226 a.a. ~ 324 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6396

Enviar un mensaje


SEC13L1 polyclonal antibody (A01)

SEC13L1 polyclonal antibody (A01)