SDCBP MaxPab rabbit polyclonal antibody (D01)
  • SDCBP MaxPab rabbit polyclonal antibody (D01)

SDCBP MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00006386-D01
SDCBP MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SDCBP protein.
Información adicional
Size 100 uL
Gene Name SDCBP
Gene Alias MDA-9|ST1|SYCL|TACIP18
Gene Description syndecan binding protein (syntenin)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SDCBP (NP_001007068.1, 1 a.a. ~ 298 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6386

Enviar un mensaje


SDCBP MaxPab rabbit polyclonal antibody (D01)

SDCBP MaxPab rabbit polyclonal antibody (D01)