CXCL5 monoclonal antibody (M03), clone M1
  • CXCL5 monoclonal antibody (M03), clone M1

CXCL5 monoclonal antibody (M03), clone M1

Ref: AB-H00006374-M03
CXCL5 monoclonal antibody (M03), clone M1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant CXCL5.
Información adicional
Size 100 ug
Gene Name CXCL5
Gene Alias ENA-78|SCYB5
Gene Description chemokine (C-X-C motif) ligand 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQKILDGGNKEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL5 (AAH08376, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6374
Clone Number M1
Iso type IgG1 lambda

Enviar un mensaje


CXCL5 monoclonal antibody (M03), clone M1

CXCL5 monoclonal antibody (M03), clone M1