CXCL11 polyclonal antibody (A01)
  • CXCL11 polyclonal antibody (A01)

CXCL11 polyclonal antibody (A01)

Ref: AB-H00006373-A01
CXCL11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant CXCL11.
Información adicional
Size 50 uL
Gene Name CXCL11
Gene Alias H174|I-TAC|IP-9|IP9|MGC102770|SCYB11|SCYB9B|b-R1
Gene Description chemokine (C-X-C motif) ligand 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL11 (AAH05292, 1 a.a. ~ 94 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6373

Enviar un mensaje


CXCL11 polyclonal antibody (A01)

CXCL11 polyclonal antibody (A01)