CXCL6 monoclonal antibody (M10), clone 2G12
  • CXCL6 monoclonal antibody (M10), clone 2G12

CXCL6 monoclonal antibody (M10), clone 2G12

Ref: AB-H00006372-M10
CXCL6 monoclonal antibody (M10), clone 2G12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CXCL6.
Información adicional
Size 100 ug
Gene Name CXCL6
Gene Alias CKA-3|GCP-2|GCP2|SCYB6
Gene Description chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL6 (AAH13744, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6372
Clone Number 2G12
Iso type IgG2a Kappa

Enviar un mensaje


CXCL6 monoclonal antibody (M10), clone 2G12

CXCL6 monoclonal antibody (M10), clone 2G12