CXCL6 monoclonal antibody (M07), clone 2G3
  • CXCL6 monoclonal antibody (M07), clone 2G3

CXCL6 monoclonal antibody (M07), clone 2G3

Ref: AB-H00006372-M07
CXCL6 monoclonal antibody (M07), clone 2G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CXCL6.
Información adicional
Size 100 ug
Gene Name CXCL6
Gene Alias CKA-3|GCP-2|GCP2|SCYB6
Gene Description chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CXCL6 (AAH13744, 38 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6372
Clone Number 2G3
Iso type IgG2b Kappa

Enviar un mensaje


CXCL6 monoclonal antibody (M07), clone 2G3

CXCL6 monoclonal antibody (M07), clone 2G3