Ver mas grande
CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)
AB-H00006372-D01P
Producto nuevo
CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CXCL6 |
| Gene Alias | CKA-3|GCP-2|GCP2|SCYB6 |
| Gene Description | chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | CXCL6 (NP_002984.1, 1 a.a. ~ 114 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6372 |
Más información
Rabbit polyclonal antibody raised against a full-length human CXCL6 protein.