CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)
  • CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)

CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006372-D01P
CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CXCL6 protein.
Información adicional
Size 100 ug
Gene Name CXCL6
Gene Alias CKA-3|GCP-2|GCP2|SCYB6
Gene Description chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CXCL6 (NP_002984.1, 1 a.a. ~ 114 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6372

Enviar un mensaje


CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)

CXCL6 purified MaxPab rabbit polyclonal antibody (D01P)