SCTR monoclonal antibody (M01), clone 3H1
  • SCTR monoclonal antibody (M01), clone 3H1

SCTR monoclonal antibody (M01), clone 3H1

Ref: AB-H00006344-M01
SCTR monoclonal antibody (M01), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SCTR.
Información adicional
Size 100 ug
Gene Name SCTR
Gene Alias SR
Gene Description secretin receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq CDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCTR (NP_002971, 32 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6344
Clone Number 3H1
Iso type IgG2a Kappa

Enviar un mensaje


SCTR monoclonal antibody (M01), clone 3H1

SCTR monoclonal antibody (M01), clone 3H1