SCP2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SCP2 purified MaxPab rabbit polyclonal antibody (D01P)

SCP2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006342-D01P
SCP2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SCP2 protein.
Información adicional
Size 100 ug
Gene Name SCP2
Gene Alias DKFZp686C12188|DKFZp686D11188|NLTP|NSL-TP|SCPX
Gene Description sterol carrier protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCP2 (NP_001007099.1, 1 a.a. ~ 322 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6342

Enviar un mensaje


SCP2 purified MaxPab rabbit polyclonal antibody (D01P)

SCP2 purified MaxPab rabbit polyclonal antibody (D01P)