SCO1 polyclonal antibody (A01)
  • SCO1 polyclonal antibody (A01)

SCO1 polyclonal antibody (A01)

Ref: AB-H00006341-A01
SCO1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SCO1.
Información adicional
Size 50 uL
Gene Name SCO1
Gene Alias SCOD1
Gene Description SCO cytochrome oxidase deficient homolog 1 (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SIDPERDTKEAIANYVKEFSPKLVGLTGTREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYRKKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCO1 (NP_004580, 202 a.a. ~ 301 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6341

Enviar un mensaje


SCO1 polyclonal antibody (A01)

SCO1 polyclonal antibody (A01)