SCN2A2 polyclonal antibody (A01)
  • SCN2A2 polyclonal antibody (A01)

SCN2A2 polyclonal antibody (A01)

Ref: AB-H00006326-A01
SCN2A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SCN2A2.
Información adicional
Size 50 uL
Gene Name SCN2A
Gene Alias HBA|HBSCI|HBSCII|NAC2|Na(v)1.2|Nav1.2|SCN2A1|SCN2A2
Gene Description sodium channel, voltage-gated, type II, alpha subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SCN2A2 (NP_066287, 273 a.a. ~ 362 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6326

Enviar un mensaje


SCN2A2 polyclonal antibody (A01)

SCN2A2 polyclonal antibody (A01)