SCML1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SCML1 purified MaxPab rabbit polyclonal antibody (D01P)

SCML1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006322-D01P
SCML1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SCML1 protein.
Información adicional
Size 100 ug
Gene Name SCML1
Gene Alias -
Gene Description sex comb on midleg-like 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYSTDHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVLLKHLGVKLGTAVKLCYYIDRLKQGKCFEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SCML1 (NP_001032624.1, 1 a.a. ~ 208 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6322

Enviar un mensaje


SCML1 purified MaxPab rabbit polyclonal antibody (D01P)

SCML1 purified MaxPab rabbit polyclonal antibody (D01P)