SERPINB3 monoclonal antibody (M01), clone 2F5
  • SERPINB3 monoclonal antibody (M01), clone 2F5

SERPINB3 monoclonal antibody (M01), clone 2F5

Ref: AB-H00006317-M01
SERPINB3 monoclonal antibody (M01), clone 2F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SERPINB3.
Información adicional
Size 100 ug
Gene Name SERPINB3
Gene Alias HsT1196|SCC|SCCA-1|SCCA-PD|SCCA1|T4-A
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINB3 (NP_008850, 276 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6317
Clone Number 2F5
Iso type IgG2a Kappa

Enviar un mensaje


SERPINB3 monoclonal antibody (M01), clone 2F5

SERPINB3 monoclonal antibody (M01), clone 2F5