SERPINB3 purified MaxPab rabbit polyclonal antibody (D01P)
  • SERPINB3 purified MaxPab rabbit polyclonal antibody (D01P)

SERPINB3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006317-D01P
SERPINB3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SERPINB3 protein.
Información adicional
Size 100 ug
Gene Name SERPINB3
Gene Alias HsT1196|SCC|SCCA-1|SCCA-PD|SCCA1|T4-A
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINB3 (NP_008850.1, 1 a.a. ~ 390 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6317

Enviar un mensaje


SERPINB3 purified MaxPab rabbit polyclonal antibody (D01P)

SERPINB3 purified MaxPab rabbit polyclonal antibody (D01P)