SARS purified MaxPab rabbit polyclonal antibody (D01P)
  • SARS purified MaxPab rabbit polyclonal antibody (D01P)

SARS purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006301-D01P
SARS purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SARS protein.
Información adicional
Size 100 ug
Gene Name SARS
Gene Alias FLJ36399|SERRS|SERS
Gene Description seryl-tRNA synthetase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEVMQEVAQLSQFDEELYKVIGKGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SARS (NP_006504.2, 1 a.a. ~ 514 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6301

Enviar un mensaje


SARS purified MaxPab rabbit polyclonal antibody (D01P)

SARS purified MaxPab rabbit polyclonal antibody (D01P)