SAFB monoclonal antibody (M04), clone 5A11
  • SAFB monoclonal antibody (M04), clone 5A11

SAFB monoclonal antibody (M04), clone 5A11

Ref: AB-H00006294-M04
SAFB monoclonal antibody (M04), clone 5A11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SAFB.
Información adicional
Size 100 ug
Gene Name SAFB
Gene Alias DKFZp779C1727|HAP|HET|SAFB1
Gene Description scaffold attachment factor B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SAFB (NP_002958, 111 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6294
Clone Number 5A11
Iso type IgG2b Kappa

Enviar un mensaje


SAFB monoclonal antibody (M04), clone 5A11

SAFB monoclonal antibody (M04), clone 5A11