Ver mas grande
SAA4 purified MaxPab mouse polyclonal antibody (B03P)
AB-H00006291-B03P
Producto nuevo
SAA4 purified MaxPab mouse polyclonal antibody (B03P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | SAA4 |
| Gene Alias | C-SAA|CSAA |
| Gene Description | serum amyloid A4, constitutive |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr |
| Immunogen Prot. Seq | MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | SAA4 (AAH07026.1, 1 a.a. ~ 130 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6291 |
Más información
Mouse polyclonal antibody raised against a full-length human SAA4 protein.