SAA4 polyclonal antibody (A01)
  • SAA4 polyclonal antibody (A01)

SAA4 polyclonal antibody (A01)

Ref: AB-H00006291-A01
SAA4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SAA4.
Información adicional
Size 50 uL
Gene Name SAA4
Gene Alias C-SAA|CSAA
Gene Description serum amyloid A4, constitutive
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SAA4 (AAH07026, 1 a.a. ~ 130 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6291

Enviar un mensaje


SAA4 polyclonal antibody (A01)

SAA4 polyclonal antibody (A01)