SAA2 polyclonal antibody (A01)
  • SAA2 polyclonal antibody (A01)

SAA2 polyclonal antibody (A01)

Ref: AB-H00006289-A01
SAA2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SAA2.
Información adicional
Size 50 uL
Gene Name SAA2
Gene Alias -
Gene Description serum amyloid A2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGHGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SAA2 (NP_110381, 26 a.a. ~ 122 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6289

Enviar un mensaje


SAA2 polyclonal antibody (A01)

SAA2 polyclonal antibody (A01)