S100A7 monoclonal antibody (M15), clone 3A5
  • S100A7 monoclonal antibody (M15), clone 3A5

S100A7 monoclonal antibody (M15), clone 3A5

Ref: AB-H00006278-M15
S100A7 monoclonal antibody (M15), clone 3A5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant S100A7.
Información adicional
Size 100 ug
Gene Name S100A7
Gene Alias PSOR1|S100A7c
Gene Description S100 calcium binding protein A7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6278
Clone Number 3A5
Iso type IgG2b Kappa

Enviar un mensaje


S100A7 monoclonal antibody (M15), clone 3A5

S100A7 monoclonal antibody (M15), clone 3A5