Ver mas grande
S100A7 monoclonal antibody (M07A), clone 3E11
AB-H00006278-M07A
Producto nuevo
S100A7 monoclonal antibody (M07A), clone 3E11
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 200 uL |
| Gene Name | S100A7 |
| Gene Alias | PSOR1|S100A7c |
| Gene Description | S100 calcium binding protein A7 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,IP,ELISA |
| Immunogen Prot. Seq | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | S100A7 (AAH34687.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In ascites fluid |
| Gene ID | 6278 |
| Clone Number | 3E11 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a full-length recombinant S100A7.