S100A3 polyclonal antibody (A01)
  • S100A3 polyclonal antibody (A01)

S100A3 polyclonal antibody (A01)

Ref: AB-H00006274-A01
S100A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant S100A3.
Información adicional
Size 50 uL
Gene Name S100A3
Gene Alias S100E
Gene Description S100 calcium binding protein A3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen S100A3 (NP_002951, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6274

Enviar un mensaje


S100A3 polyclonal antibody (A01)

S100A3 polyclonal antibody (A01)