Ver mas grande
S100A2 monoclonal antibody (M01), clone 2D10-A3
AB-H00006273-M01
Producto nuevo
S100A2 monoclonal antibody (M01), clone 2D10-A3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | S100A2 |
| Gene Alias | CAN19|MGC111539|S100L |
| Gene Description | S100 calcium binding protein A2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | S100A2 (AAH02829, 1 a.a. ~ 97 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6273 |
| Clone Number | 2D10-A3 |
| Iso type | IgG2a kappa |
Más información
Mouse monoclonal antibody raised against a full length recombinant S100A2.